| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Class I MHC, alpha-3 domain [88604] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88605] (203 PDB entries) Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor |
| Domain d4l29m2: 4l29 M:182-276 [253495] Other proteins in same PDB: d4l29a1, d4l29b1, d4l29b2, d4l29c1, d4l29d1, d4l29d2, d4l29e1, d4l29f1, d4l29f2, d4l29g1, d4l29h1, d4l29h2, d4l29i1, d4l29j1, d4l29j2, d4l29k1, d4l29l1, d4l29l2, d4l29m1, d4l29n1, d4l29n2, d4l29o1, d4l29p1, d4l29p2, d4l29q1, d4l29r1, d4l29r2, d4l29s1, d4l29t1, d4l29t2, d4l29u1, d4l29v1, d4l29v2, d4l29w1, d4l29x1, d4l29x2, d4l29y1, d4l29z1, d4l29z2 automated match to d1ogaa1 complexed with cl, gol; mutant |
PDB Entry: 4l29 (more details), 3.09 Å
SCOPe Domain Sequences for d4l29m2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l29m2 b.1.1.2 (M:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwep
Timeline for d4l29m2:
View in 3DDomains from other chains: (mouse over for more information) d4l29a1, d4l29a2, d4l29b1, d4l29b2, d4l29c1, d4l29c2, d4l29d1, d4l29d2, d4l29e1, d4l29e2, d4l29f1, d4l29f2, d4l29g1, d4l29g2, d4l29h1, d4l29h2, d4l29i1, d4l29i2, d4l29j1, d4l29j2, d4l29k1, d4l29k2, d4l29l1, d4l29l2, d4l29n1, d4l29n2, d4l29o1, d4l29o2, d4l29p1, d4l29p2, d4l29q1, d4l29q2, d4l29r1, d4l29r2, d4l29s1, d4l29s2, d4l29t1, d4l29t2, d4l29u1, d4l29u2, d4l29v1, d4l29v2, d4l29w1, d4l29w2, d4l29x1, d4l29x2, d4l29y1, d4l29y2, d4l29z1, d4l29z2 |