SCOP 1.55: Domain d1jmca1: 1jmc A:183-298

Lineage for d1jmca1 (1jmc A:183-298)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.40: OB-fold [50198] (7 superfamilies)

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (6 proteins)

6. Protein Replication protein A 70 KDa subunit (RPA70) fragment [50267] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50268] (3 PDB entries)

8. Domain d1jmca1: 1jmc A:183-298 [25300]

Details for d1jmca1

PDB Entry: 1jmc, 2.4 Å

PDB Description: single stranded dna-binding domain of human replication protein a bound to single stranded dna, rpa70 subunit, residues 183-420

PDB Compounds: (A:) protein (replication protein a (rpa))

SCOP Domain Sequences for d1jmca1:

Sequence; same for both SEQRES and ATOM records:

>d1jmca1 b.40.4.3 (A:183-298) Replication protein A 70 KDa subunit (RPA70) fragment {Human (Homo sapiens)}
kvvpiasltpyqskwticarvtnksqirtwsnsrgegklfslelvdesgeiratafneqv
dkffplievnkvyyfskgtlkiankqftavkndyemtfnnetsvmpceddhhlptv

Timeline for d1jmca1:

• d1jmca1 appears in SCOP 1.57
  
• d1jmca1 appears in the current release, SCOPe 2.08