PDB entry 1jmc

View 1jmc on RCSB PDB site
Description: single stranded DNA-binding domain of human replication protein a bound to single stranded DNA, rpa70 subunit, residues 183-420
Class: replication/DNA
Keywords: human ssDNA binding replication protein a(rpa), single stranded DNA-binding protein, protein-ssDNA complex, complex (DNA-binding protein/DNA)
Deposited on 1996-11-11, released 1997-10-15
The last revision prior to the SCOP 1.55 freeze date was dated 1997-10-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.212
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (replication protein a (rpa))
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.55: d1jmca1, d1jmca2
  • Chain 'B':
    Compound: DNA (5'-d(*cp*cp*cp*cp*cp*cp*cp*c)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1jmcA (A:)
    kvvpiasltpyqskwticarvtnksqirtwsnsrgegklfslelvdesgeiratafneqv
    dkffplievnkvyyfskgtlkiankqftavkndyemtfnnetsvmpceddhhlptvqfdf
    tgiddlenkskdslvdiigicksyedatkitvrsnnrevakrniylmdtsgkvvtatlwg
    edadkfdgsrqpvlaikgarvsdfggrslsvlssstiianpdipeayklrgwfdaegq
    

  • Chain 'B':
    No sequence available.