Lineage for d1jmca2 (1jmc A:299-420)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14109Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (6 proteins)
  6. 14121Protein Replication protein A 70 KDa subunit (RPA70) fragment [50267] (1 species)
  7. 14122Species Human (Homo sapiens) [TaxId:9606] [50268] (3 PDB entries)
  8. 14128Domain d1jmca2: 1jmc A:299-420 [25301]

Details for d1jmca2

PDB Entry: 1jmc (more details), 2.4 Å

PDB Description: single stranded dna-binding domain of human replication protein a bound to single stranded dna, rpa70 subunit, residues 183-420
PDB Compounds: (A:) protein (replication protein a (rpa))

SCOP Domain Sequences for d1jmca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jmca2 b.40.4.3 (A:299-420) Replication protein A 70 KDa subunit (RPA70) fragment {Human (Homo sapiens)}
qfdftgiddlenkskdslvdiigicksyedatkitvrsnnrevakrniylmdtsgkvvta
tlwgedadkfdgsrqpvlaikgarvsdfggrslsvlssstiianpdipeayklrgwfdae
gq

SCOP Domain Coordinates for d1jmca2:

Click to download the PDB-style file with coordinates for d1jmca2.
(The format of our PDB-style files is described here.)

Timeline for d1jmca2: