Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins) automatically mapped to Pfam PF01325 |
Protein automated matches [233395] (2 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [234698] (4 PDB entries) |
Domain d4hx7b1: 4hx7 B:3-62 [252540] Other proteins in same PDB: d4hx7a2, d4hx7b2 automated match to d4hx4a1 complexed with cd; mutant |
PDB Entry: 4hx7 (more details), 1.9 Å
SCOPe Domain Sequences for d4hx7b1:
Sequence, based on SEQRES records: (download)
>d4hx7b1 a.4.5.24 (B:3-62) automated matches {Bacillus subtilis [TaxId: 224308]} tpsmedyikqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvl
>d4hx7b1 a.4.5.24 (B:3-62) automated matches {Bacillus subtilis [TaxId: 224308]} tpsmedyikqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyglvl
Timeline for d4hx7b1: