SCOPe 2.08: Domain d4hx7b2: 4hx7 B:63-136

Lineage for d4hx7b2 (4hx7 B:63-136)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families)
   automatically mapped to Pfam PF02742

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)

6. Protein automated matches [233398] (2 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [234701] (4 PDB entries)

8. Domain d4hx7b2: 4hx7 B:63-136 [252541]
   Other proteins in same PDB: d4hx7a1, d4hx7b1
   automated match to d4hx4a2
   complexed with cd; mutant

Details for d4hx7b2

PDB Entry: 4hx7, 1.9 Å

PDB Description: Structure of MNTR E11K mutant complexed with Cd2+

PDB Compounds: (B:) Transcriptional regulator mntR

SCOPe Domain Sequences for d4hx7b2:

Sequence; same for both SEQRES and ATOM records:

>d4hx7b2 a.76.1.1 (B:63-136) automated matches {Bacillus subtilis [TaxId: 224308]}
tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiqkk

Timeline for d4hx7b2:

• d4hx7b2 first appeared in SCOPe 2.04
  
• d4hx7b2 appears in SCOPe 2.07