Lineage for d4hx4a1 (4hx4 A:3-62)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693576Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
    automatically mapped to Pfam PF01325
  6. 2693661Protein automated matches [233395] (2 species)
    not a true protein
  7. 2693662Species Bacillus subtilis [TaxId:1423] [233396] (3 PDB entries)
  8. 2693663Domain d4hx4a1: 4hx4 A:3-62 [234729]
    Other proteins in same PDB: d4hx4a2, d4hx4b2
    automated match to d1on1a1
    complexed with mn; mutant

Details for d4hx4a1

PDB Entry: 4hx4 (more details), 1.65 Å

PDB Description: Structure of MNTR mutant E11K complexed with Mn2+
PDB Compounds: (A:) Transcriptional regulator mntR

SCOPe Domain Sequences for d4hx4a1:

Sequence, based on SEQRES records: (download)

>d4hx4a1 a.4.5.24 (A:3-62) automated matches {Bacillus subtilis [TaxId: 1423]}
tpsmedyikqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvl

Sequence, based on observed residues (ATOM records): (download)

>d4hx4a1 a.4.5.24 (A:3-62) automated matches {Bacillus subtilis [TaxId: 1423]}
tpsmedyikqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliglvl

SCOPe Domain Coordinates for d4hx4a1:

Click to download the PDB-style file with coordinates for d4hx4a1.
(The format of our PDB-style files is described here.)

Timeline for d4hx4a1:

2693663
d4hx4a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4hx4a2