Lineage for d1on1a1 (1on1 A:2-62)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) 
contains a small beta-sheet (wing)
Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
automatically mapped to Pfam PF01325Protein Manganese transport regulator MntR [88986] (1 species) Species Bacillus subtilis [TaxId:1423] [88987] (11 PDB entries) 
Domain d1on1a1: 1on1 A:2-62 [87099]
Other proteins in same PDB: d1on1a2, d1on1b2
complexed with mn
Details for d1on1a1
PDB Entry: 1on1 (more details), 1.75 Å
PDB Description: Bacillus Subtilis Manganese Transport Regulator (Mntr) Bound To Manganese, AB Conformation.
PDB Compounds: (A:) Transcriptional regulator mntRSCOPe Domain Sequences for d1on1a1:
Sequence, based on SEQRES records: (download)
>d1on1a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
l
Sequence, based on observed residues (ATOM records): (download)
>d1on1a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliglvl
SCOPe Domain Coordinates for d1on1a1:
Click to download the PDB-style file with coordinates for d1on1a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1on1a1:
- d1on1a1 first appeared in SCOP 1.65
- d1on1a1 appears in SCOPe 2.07
View in 3D
