Lineage for d1efwa1 (1efw A:1-104)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
    barrel, closed; n=5, S=10
  6. Protein Aspartyl-tRNA synthetase (AspRS) [50251] (5 species)
    this is N-terminal domain in prokaryotic enzymes and the first "visible" domain in eukaryotic enzymes
  7. Species Thermus thermophilus, AspRS-1 [TaxId:274] [50255] (3 PDB entries)
  8. Domain d1efwa1: 1efw A:1-104 [25252]
    Other proteins in same PDB: d1efwa2, d1efwa3, d1efwb2, d1efwb3
    protein/RNA complex

Details for d1efwa1

PDB Entry: 1efw (more details), 3 Å

PDB Description: Crystal structure of aspartyl-tRNA synthetase from Thermus thermophilus complexed to tRNAasp from Escherichia coli
PDB Compounds: (A:) ASPARTYL-tRNA SYNTHETASE

SCOPe Domain Sequences for d1efwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efwa1 b.40.4.1 (A:1-104) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus, AspRS-1 [TaxId: 274]}
mrrthyagslrethvgeevvlegwvnrrrdlgglifldlrdreglvqlvahpaspayata
ervrpewvvrakglvrlrpepnprlatgrvevelsalevlaeak

SCOPe Domain Coordinates for d1efwa1 are not available.

Timeline for d1efwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1efwa2, d1efwa3
View in 3D
Domains from other chains:
(mouse over for more information)
d1efwb1, d1efwb2, d1efwb3