PDB entry 1efw

View 1efw on RCSB PDB site
Description: Crystal structure of aspartyl-tRNA synthetase from Thermus thermophilus complexed to tRNAasp from Escherichia coli
Class: ligase/RNA
Keywords: aspartyl-tRNA synthetase, tRNA, protein/RNA complex, ligase/RNA
Deposited on 2000-02-10, released 2000-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.248
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ASPARTYL-tRNA SYNTHETASE
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1efwa1, d1efwa2, d1efwa3
  • Chain 'B':
    Compound: ASPARTYL-tRNA SYNTHETASE
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1efwb1, d1efwb2, d1efwb3
  • Chain 'C':
    Compound: aspartyl-tRNA
    Species: Escherichia coli [TaxId:562]
  • Chain 'D':
    Compound: aspartyl-tRNA
    Species: Escherichia coli [TaxId:562]
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1efwA (A:)
    mrrthyagslrethvgeevvlegwvnrrrdlgglifldlrdreglvqlvahpaspayata
    ervrpewvvrakglvrlrpepnprlatgrvevelsalevlaeaktppfpvdagwrgeeek
    easeelrlkyryldlrrrrmqenlrlrhrvikaiwdfldregfvqvetpfltkstpegar
    dflvpyrhepglfyalpqspqlfkqmlmvagldryfqiarcfrdedlradrqpdftqldl
    emsfvevedvlelnerlmahvfrealgvelplpfprlsyeeamerygsdkpdlrfglelk
    evgplfrqsgfrvfqeaesvkalalpkalsrkevaeleevakrhkaqglawarveeggfs
    ggvakflepvreallqatearpgdtllfvagprkvaatalgavrlraadllglkregfrf
    lwvvdfpllewdeeeeawtymhhpftsphpedlpllekdpgrvralaydlvlngvevggg
    sirihdprlqarvfrllgigeeeqrekfgfflealeygapphggiawgldrllalmtgsp
    sireviafpknkegkdpltgapspvpeeqlrelglmvvrp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1efwB (B:)
    mrrthyagslrethvgeevvlegwvnrrrdlgglifldlrdreglvqlvahpaspayata
    ervrpewvvrakglvrlrpepnprlatgrvevelsalevlaeaktppfpvdagwrgeeek
    easeelrlkyryldlrrrrmqenlrlrhrvikaiwdfldregfvqvetpfltkstpegar
    dflvpyrhepglfyalpqspqlfkqmlmvagldryfqiarcfrdedlradrqpdftqldl
    emsfvevedvlelnerlmahvfrealgvelplpfprlsyeeamerygsdkpdlrfglelk
    evgplfrqsgfrvfqeaesvkalalpkalsrkevaeleevakrhkaqglawarveeggfs
    ggvakflepvreallqatearpgdtllfvagprkvaatalgavrlraadllglkregfrf
    lwvvdfpllewdeeeeawtymhhpftsphpedlpllekdpgrvralaydlvlngvevggg
    sirihdprlqarvfrllgigeeeqrekfgfflealeygapphggiawgldrllalmtgsp
    sireviafpknkegkdpltgapspvpeeqlrelglmvvrp
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.