Lineage for d1efwa1 (1efw A:1-104)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14053Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins)
  6. 14054Protein Aspartyl-tRNA synthetase (AspRS) [50251] (4 species)
  7. 14069Species Thermus thermophilus [TaxId:274] [50255] (2 PDB entries)
  8. 14072Domain d1efwa1: 1efw A:1-104 [25252]
    Other proteins in same PDB: d1efwa2, d1efwa3, d1efwb2, d1efwb3

Details for d1efwa1

PDB Entry: 1efw (more details), 3 Å

PDB Description: Crystal structure of aspartyl-tRNA synthetase from Thermus thermophilus complexed to tRNAasp from Escherichia coli

SCOP Domain Sequences for d1efwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efwa1 b.40.4.1 (A:1-104) Aspartyl-tRNA synthetase (AspRS) {Thermus thermophilus}
mrrthyagslrethvgeevvlegwvnrrrdlgglifldlrdreglvqlvahpaspayata
ervrpewvvrakglvrlrpepnprlatgrvevelsalevlaeak

SCOP Domain Coordinates for d1efwa1:

Click to download the PDB-style file with coordinates for d1efwa1.
(The format of our PDB-style files is described here.)

Timeline for d1efwa1: