![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
![]() | Superfamily d.74.4: GAD domain-like [55261] (2 families) ![]() |
![]() | Family d.74.4.1: GAD domain [55262] (2 proteins) has additional structures inserted in the common fold loops |
![]() | Protein Prokaryotic AspRS, insert domain [55263] (2 species) |
![]() | Species Thermus thermophilus, AspRS-1 [TaxId:274] [55265] (3 PDB entries) |
![]() | Domain d1efwa2: 1efw A:295-414 [39737] Other proteins in same PDB: d1efwa1, d1efwa3, d1efwb1, d1efwb3 protein/RNA complex |
PDB Entry: 1efw (more details), 3 Å
SCOPe Domain Sequences for d1efwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efwa2 d.74.4.1 (A:295-414) Prokaryotic AspRS, insert domain {Thermus thermophilus, AspRS-1 [TaxId: 274]} fglelkevgplfrqsgfrvfqeaesvkalalpkalsrkevaeleevakrhkaqglawarv eeggfsggvakflepvreallqatearpgdtllfvagprkvaatalgavrlraadllglk
Timeline for d1efwa2: