![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Dogfish (Squalus acanthias) [TaxId:7797] [226656] (2 PDB entries) |
![]() | Domain d4hgkd1: 4hgk D:20-122 [252447] Other proteins in same PDB: d4hgka1, d4hgka2, d4hgkb1, d4hgkb2, d4hgkc2, d4hgkd2 automated match to d4hgma_ |
PDB Entry: 4hgk (more details), 3.04 Å
SCOPe Domain Sequences for d4hgkd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hgkd1 b.1.1.1 (D:20-122) automated matches {Dogfish (Squalus acanthias) [TaxId: 7797]} trvdqtprtatretgesltincvltdtsyplystywyrknpgssnkeqisisgryvesvn kgtksfslrikdltvadsatyicramgtniwtgdgagtvltvn
Timeline for d4hgkd1: