SCOPe 2.08: Domain d4hgkd1: 4hgk D:20-122

Lineage for d4hgkd1 (4hgk D:20-122)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Dogfish (Squalus acanthias) [TaxId:7797] [226656] (2 PDB entries)

8. Domain d4hgkd1: 4hgk D:20-122 [252447]
   Other proteins in same PDB: d4hgka1, d4hgka2, d4hgkb1, d4hgkb2, d4hgkc2, d4hgkd2
   automated match to d4hgma_

Details for d4hgkd1

PDB Entry: 4hgk, 3.04 Å

PDB Description: Shark IgNAR variable domain

PDB Compounds: (D:) shark V-NAR antibody

SCOPe Domain Sequences for d4hgkd1:

Sequence; same for both SEQRES and ATOM records:

>d4hgkd1 b.1.1.1 (D:20-122) automated matches {Dogfish (Squalus acanthias) [TaxId: 7797]}
trvdqtprtatretgesltincvltdtsyplystywyrknpgssnkeqisisgryvesvn
kgtksfslrikdltvadsatyicramgtniwtgdgagtvltvn

Timeline for d4hgkd1:

• d4hgkd1 first appeared in SCOPe 2.04, called d4hgkd_
  
• d4hgkd1 appears in SCOPe 2.07