SCOPe 2.08: Domain d4hgkb2: 4hgk B:197-388

Lineage for d4hgkb2 (4hgk B:197-388)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.0: automated matches [254216] (1 protein)
   not a true family

6. Protein automated matches [254493] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255068] (17 PDB entries)

8. Domain d4hgkb2: 4hgk B:197-388 [252445]
   Other proteins in same PDB: d4hgkc1, d4hgkc2, d4hgkd1, d4hgkd2
   automated match to d4l8ua2

Details for d4hgkb2

PDB Entry: 4hgk, 3.04 Å

PDB Description: Shark IgNAR variable domain

PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d4hgkb2:

Sequence; same for both SEQRES and ATOM records:

>d4hgkb2 a.126.1.0 (B:197-388) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd
radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc
knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde
fkplveepqnli

Timeline for d4hgkb2:

• d4hgkb2 first appeared in SCOPe 2.04
  
• d4hgkb2 appears in SCOPe 2.07