Class a: All alpha proteins [46456] (290 folds) |
Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) |
Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
Protein automated matches [254493] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255068] (17 PDB entries) |
Domain d4hgkb1: 4hgk B:4-196 [252444] Other proteins in same PDB: d4hgkc1, d4hgkc2, d4hgkd1, d4hgkd2 automated match to d3jrya1 |
PDB Entry: 4hgk (more details), 3.04 Å
SCOPe Domain Sequences for d4hgkb1:
Sequence, based on SEQRES records: (download)
>d4hgkb1 a.126.1.0 (B:4-196) automated matches {Human (Homo sapiens) [TaxId: 9606]} ksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencd kslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdvm ctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkld elrdegkassakq
>d4hgkb1 a.126.1.0 (B:4-196) automated matches {Human (Homo sapiens) [TaxId: 9606]} ksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencd kslhtlfgdklctvemadccakqepernecflqhkddnpnlprlvrpevdvmctafhdne etflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkldelrdegka ssakq
Timeline for d4hgkb1: