Lineage for d4hgkb1 (4hgk B:4-196)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009789Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2009790Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2010124Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2010125Protein automated matches [254493] (6 species)
    not a true protein
  7. 2010170Species Human (Homo sapiens) [TaxId:9606] [255068] (15 PDB entries)
  8. 2010212Domain d4hgkb1: 4hgk B:4-196 [252444]
    Other proteins in same PDB: d4hgkc1, d4hgkc2, d4hgkd1, d4hgkd2
    automated match to d3jrya1

Details for d4hgkb1

PDB Entry: 4hgk (more details), 3.04 Å

PDB Description: Shark IgNAR variable domain
PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d4hgkb1:

Sequence, based on SEQRES records: (download)

>d4hgkb1 a.126.1.0 (B:4-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencd
kslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdvm
ctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkld
elrdegkassakq

Sequence, based on observed residues (ATOM records): (download)

>d4hgkb1 a.126.1.0 (B:4-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaencd
kslhtlfgdklctvemadccakqepernecflqhkddnpnlprlvrpevdvmctafhdne
etflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkldelrdegka
ssakq

SCOPe Domain Coordinates for d4hgkb1:

Click to download the PDB-style file with coordinates for d4hgkb1.
(The format of our PDB-style files is described here.)

Timeline for d4hgkb1: