![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
![]() | Superfamily a.126.1: Serum albumin-like [48552] (2 families) ![]() |
![]() | Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
![]() | Protein automated matches [254493] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255068] (17 PDB entries) |
![]() | Domain d4hgka2: 4hgk A:197-388 [252443] Other proteins in same PDB: d4hgkc1, d4hgkc2, d4hgkd1, d4hgkd2 automated match to d4l8ua2 |
PDB Entry: 4hgk (more details), 3.04 Å
SCOPe Domain Sequences for d4hgka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hgka2 a.126.1.0 (A:197-388) automated matches {Human (Homo sapiens) [TaxId: 9606]} rlkcaslqkfgerafkawavarlsqrfpkaefaevsklvtdltkvhtecchgdllecadd radlakyicenqdsissklkeccekpllekshciaevendempadlpslaadfveskdvc knyaeakdvflgmflyeyarrhpdysvvlllrlaktyettlekccaaadphecyakvfde fkplveepqnli
Timeline for d4hgka2: