Lineage for d4e5ia_ (4e5i A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882703Family c.52.1.34: PA N-terminal domain [254166] (3 proteins)
    Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458
  6. 2882707Protein PA N-terminal domain [254375] (8 species)
  7. 2882737Species Influenza A virus [TaxId:93838] [254808] (91 PDB entries)
  8. 2882872Domain d4e5ia_: 4e5i A: [251681]
    automated match to d3ebja_
    complexed with 0n9, mn, so4

Details for d4e5ia_

PDB Entry: 4e5i (more details), 2.94 Å

PDB Description: crystal structure of avian influenza virus pan bound to compound 4
PDB Compounds: (A:) Polymerase protein PA

SCOPe Domain Sequences for d4e5ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e5ia_ c.52.1.34 (A:) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
egrdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankik
seethihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqseraaa

SCOPe Domain Coordinates for d4e5ia_:

Click to download the PDB-style file with coordinates for d4e5ia_.
(The format of our PDB-style files is described here.)

Timeline for d4e5ia_: