PDB entry 4e5i

View 4e5i on RCSB PDB site
Description: Crystal structure of avian influenza virus PAn bound to compound 4
Class: viral protein, transcription
Keywords: endonuclease domain, H5N1 subtype, VIRAL PROTEIN, TRANSCRIPTION
Deposited on 2012-03-14, released 2012-08-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-08-22, with a file datestamp of 2012-08-17.
Experiment type: XRAY
Resolution: 2.94 Å
R-factor: 0.322
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polymerase protein PA
    Species: Influenza A virus [TaxId:284218]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5EP34 (0-49)
    • Uniprot Q5EP34 (53-176)
      • linker (49)
      • linker (49)
      • expression tag (176)
      • expression tag (176)
      • expression tag (176)
    Domains in SCOPe 2.06: d4e5ia_
  • Chain 'B':
    Compound: Polymerase protein PA
    Species: Influenza A virus [TaxId:284218]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5EP34 (0-49)
    • Uniprot Q5EP34 (53-176)
      • linker (49)
      • linker (49)
      • expression tag (176)
      • expression tag (176)
      • expression tag (176)
    Domains in SCOPe 2.06: d4e5ib_
  • Chain 'C':
    Compound: Polymerase protein PA
    Species: Influenza A virus [TaxId:284218]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5EP34 (0-49)
    • Uniprot Q5EP34 (53-176)
      • linker (49)
      • linker (49)
      • expression tag (176)
      • expression tag (176)
      • expression tag (176)
    Domains in SCOPe 2.06: d4e5ic_
  • Chain 'D':
    Compound: Polymerase protein PA
    Species: Influenza A virus [TaxId:284218]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5EP34 (0-49)
    • Uniprot Q5EP34 (53-176)
      • linker (49)
      • linker (49)
      • expression tag (176)
      • expression tag (176)
      • expression tag (176)
    Domains in SCOPe 2.06: d4e5id_
  • Heterogens: SO4, MN, 0N9

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e5iA (A:)
    medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
    egrdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankik
    seethihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqseraaa
    elalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e5iA (A:)
    medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
    egrdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankik
    seethihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqseraaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4e5iB (B:)
    medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
    egrdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankik
    seethihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqseraaa
    elalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e5iB (B:)
    medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
    egrdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankik
    seethihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqseraaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4e5iC (C:)
    medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
    egrdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankik
    seethihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqseraaa
    elalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e5iC (C:)
    medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
    egrdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankik
    seethihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqseraaa
    el
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4e5iD (D:)
    medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
    egrdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankik
    seethihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqseraaa
    elalvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e5iD (D:)
    medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhrfeii
    egrdrtmawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhtyylekankik
    seethihifsftgeematkadytldeesrariktrlftirqemasrglwdsfrqseraaa
    ela