| Class g: Small proteins [56992] (98 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (23 proteins) |
| Protein Plasminogen activator (urokinase-type) [57221] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57222] (6 PDB entries) |
| Domain d3u73a1: 3u73 A:10-49 [250137] Other proteins in same PDB: d3u73a2, d3u73u1, d3u73u2, d3u73u3 automated match to d1urka1 complexed with nag; mutant |
PDB Entry: 3u73 (more details), 3.19 Å
SCOPe Domain Sequences for d3u73a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u73a1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}
ncdclnggtcvsnkyfsnihwcncpkkfggqhceidkskt
Timeline for d3u73a1: