Lineage for d3u73a1 (3u73 A:10-49)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1700389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1701322Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1701323Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1701624Protein Plasminogen activator (urokinase-type) [57221] (1 species)
  7. 1701625Species Human (Homo sapiens) [TaxId:9606] [57222] (6 PDB entries)
  8. 1701636Domain d3u73a1: 3u73 A:10-49 [250137]
    Other proteins in same PDB: d3u73a2, d3u73u1, d3u73u2, d3u73u3
    automated match to d1urka1
    complexed with nag; mutant

Details for d3u73a1

PDB Entry: 3u73 (more details), 3.19 Å

PDB Description: crystal structure of stabilized human upar mutant in complex with atf
PDB Compounds: (A:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d3u73a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u73a1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}
ncdclnggtcvsnkyfsnihwcncpkkfggqhceidkskt

SCOPe Domain Coordinates for d3u73a1:

Click to download the PDB-style file with coordinates for d3u73a1.
(The format of our PDB-style files is described here.)

Timeline for d3u73a1: