SCOPe 2.07: Domain d3u73u2: 3u73 U:92-187

Lineage for d3u73u2 (3u73 U:92-187)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.0: automated matches [191613] (1 protein)
   not a true family

6. Protein automated matches [191119] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [256115] (2 PDB entries)

8. Domain d3u73u2: 3u73 U:92-187 [250140]
   Other proteins in same PDB: d3u73a1, d3u73a2
   automated match to d2i9be3
   complexed with nag; mutant

Details for d3u73u2

PDB Entry: 3u73, 3.19 Å

PDB Description: crystal structure of stabilized human upar mutant in complex with atf

PDB Compounds: (U:) Urokinase plasminogen activator surface receptor

SCOPe Domain Sequences for d3u73u2:

Sequence; same for both SEQRES and ATOM records:

>d3u73u2 g.7.1.0 (U:92-187) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yleciscgssdmscergrhqslqcrspeeqcldvvthwiqegeegrpkddrhlrgcgylp
gcpgsngfhnndtfhflkccnttkcnegpilelenl

Timeline for d3u73u2:

• d3u73u2 first appeared in SCOPe 2.04
  
• d3u73u2 appears in SCOPe 2.06
  
• d3u73u2 appears in the current release, SCOPe 2.08