SCOPe 2.07: Domain d3u73a2: 3u73 A:50-132

Lineage for d3u73a2 (3u73 A:50-132)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein Urokinase-type plasminogen activator [57453] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57454] (7 PDB entries)

8. Domain d3u73a2: 3u73 A:50-132 [250138]
   Other proteins in same PDB: d3u73a1, d3u73u1, d3u73u2, d3u73u3
   automated match to d1urka2
   complexed with nag; mutant

Details for d3u73a2

PDB Entry: 3u73, 3.19 Å

PDB Description: crystal structure of stabilized human upar mutant in complex with atf

PDB Compounds: (A:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d3u73a2:

Sequence; same for both SEQRES and ATOM records:

>d3u73a2 g.14.1.1 (A:50-132) Urokinase-type plasminogen activator {Human (Homo sapiens) [TaxId: 9606]}
cyegnghfyrgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrr
rpwcyvqvglkplvqecmvhdca

Timeline for d3u73a2:

• d3u73a2 first appeared in SCOPe 2.04
  
• d3u73a2 appears in SCOPe 2.06
  
• d3u73a2 appears in the current release, SCOPe 2.08