Class g: Small proteins [56992] (98 folds) |
Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (3 families) |
Family g.14.1.1: Kringle modules [57441] (7 proteins) |
Protein Urokinase-type plasminogen activator [57453] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57454] (7 PDB entries) |
Domain d3u73a2: 3u73 A:50-132 [250138] Other proteins in same PDB: d3u73a1, d3u73u1, d3u73u2, d3u73u3 automated match to d1urka2 complexed with nag; mutant |
PDB Entry: 3u73 (more details), 3.19 Å
SCOPe Domain Sequences for d3u73a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u73a2 g.14.1.1 (A:50-132) Urokinase-type plasminogen activator {Human (Homo sapiens) [TaxId: 9606]} cyegnghfyrgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrr rpwcyvqvglkplvqecmvhdca
Timeline for d3u73a2: