SCOPe 2.08: Domain d1ghon4: 1gho N:731-1023

Lineage for d1ghon4 (1gho N:731-1023)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families)
   probable carbohydrate-binding domain in enzymes acting on sugars

5. Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
   automatically mapped to Pfam PF02929

6. Protein beta-Galactosidase, domain 5 [49996] (2 species)

7. Species Escherichia coli [TaxId:562] [49997] (46 PDB entries)
   Uniprot P00722

8. Domain d1ghon4: 1gho N:731-1023 [24379]
   Other proteins in same PDB: d1ghoi1, d1ghoi2, d1ghoi3, d1ghoi5, d1ghoj1, d1ghoj2, d1ghoj3, d1ghoj5, d1ghok1, d1ghok2, d1ghok3, d1ghok5, d1ghol1, d1ghol2, d1ghol3, d1ghol5, d1ghom1, d1ghom2, d1ghom3, d1ghom5, d1ghon1, d1ghon2, d1ghon3, d1ghon5, d1ghoo1, d1ghoo2, d1ghoo3, d1ghoo5, d1ghop1, d1ghop2, d1ghop3, d1ghop5
   complexed with mg
   complexed with mg

Details for d1ghon4

PDB Entry: 1gho, 2.5 Å

PDB Description: e. coli (lac z) beta-galactosidase (ncs constrained monomer-monoclinic)

PDB Compounds: (N:) beta-galactosidase

SCOPe Domain Sequences for d1ghon4:

Sequence; same for both SEQRES and ATOM records:

>d1ghon4 b.30.5.1 (N:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

Timeline for d1ghon4:

• d1ghon4 first appeared (with stable ids) in SCOP 1.55
  
• d1ghon4 appears in SCOPe 2.07