| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
| Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
| Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) |
| Species Escherichia coli [TaxId:562] [49306] (46 PDB entries) Uniprot P00722 |
| Domain d1ghol2: 1gho L:626-730 [22136] Other proteins in same PDB: d1ghoi3, d1ghoi4, d1ghoi5, d1ghoj3, d1ghoj4, d1ghoj5, d1ghok3, d1ghok4, d1ghok5, d1ghol3, d1ghol4, d1ghol5, d1ghom3, d1ghom4, d1ghom5, d1ghon3, d1ghon4, d1ghon5, d1ghoo3, d1ghoo4, d1ghoo5, d1ghop3, d1ghop4, d1ghop5 complexed with mg complexed with mg |
PDB Entry: 1gho (more details), 2.5 Å
SCOPe Domain Sequences for d1ghol2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ghol2 b.1.4.1 (L:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d1ghol2:
View in 3DDomains from same chain: (mouse over for more information) d1ghol1, d1ghol3, d1ghol4, d1ghol5 |
View in 3DDomains from other chains: (mouse over for more information) d1ghoi1, d1ghoi2, d1ghoi3, d1ghoi4, d1ghoi5, d1ghoj1, d1ghoj2, d1ghoj3, d1ghoj4, d1ghoj5, d1ghok1, d1ghok2, d1ghok3, d1ghok4, d1ghok5, d1ghom1, d1ghom2, d1ghom3, d1ghom4, d1ghom5, d1ghon1, d1ghon2, d1ghon3, d1ghon4, d1ghon5, d1ghoo1, d1ghoo2, d1ghoo3, d1ghoo4, d1ghoo5, d1ghop1, d1ghop2, d1ghop3, d1ghop4, d1ghop5 |