Lineage for d1ghol4 (1gho L:731-1023)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781620Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2781621Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2781622Protein beta-Galactosidase, domain 5 [49996] (2 species)
  7. 2781630Species Escherichia coli [TaxId:562] [49997] (46 PDB entries)
    Uniprot P00722
  8. 2781762Domain d1ghol4: 1gho L:731-1023 [24377]
    Other proteins in same PDB: d1ghoi1, d1ghoi2, d1ghoi3, d1ghoi5, d1ghoj1, d1ghoj2, d1ghoj3, d1ghoj5, d1ghok1, d1ghok2, d1ghok3, d1ghok5, d1ghol1, d1ghol2, d1ghol3, d1ghol5, d1ghom1, d1ghom2, d1ghom3, d1ghom5, d1ghon1, d1ghon2, d1ghon3, d1ghon5, d1ghoo1, d1ghoo2, d1ghoo3, d1ghoo5, d1ghop1, d1ghop2, d1ghop3, d1ghop5
    complexed with mg
    complexed with mg

Details for d1ghol4

PDB Entry: 1gho (more details), 2.5 Å

PDB Description: e. coli (lac z) beta-galactosidase (ncs constrained monomer-monoclinic)
PDB Compounds: (L:) beta-galactosidase

SCOPe Domain Sequences for d1ghol4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghol4 b.30.5.1 (L:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d1ghol4:

Click to download the PDB-style file with coordinates for d1ghol4.
(The format of our PDB-style files is described here.)

Timeline for d1ghol4: