| Class b: All beta proteins [48724] (180 folds) |
| Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
| Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein) automatically mapped to Pfam PF02929 |
| Protein beta-Galactosidase, domain 5 [49996] (2 species) |
| Species Escherichia coli [TaxId:562] [49997] (46 PDB entries) Uniprot P00722 |
| Domain d1ghoo4: 1gho O:731-1023 [24380] Other proteins in same PDB: d1ghoi1, d1ghoi2, d1ghoi3, d1ghoi5, d1ghoj1, d1ghoj2, d1ghoj3, d1ghoj5, d1ghok1, d1ghok2, d1ghok3, d1ghok5, d1ghol1, d1ghol2, d1ghol3, d1ghol5, d1ghom1, d1ghom2, d1ghom3, d1ghom5, d1ghon1, d1ghon2, d1ghon3, d1ghon5, d1ghoo1, d1ghoo2, d1ghoo3, d1ghoo5, d1ghop1, d1ghop2, d1ghop3, d1ghop5 complexed with mg complexed with mg |
PDB Entry: 1gho (more details), 2.5 Å
SCOPe Domain Sequences for d1ghoo4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ghoo4 b.30.5.1 (O:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d1ghoo4:
View in 3DDomains from same chain: (mouse over for more information) d1ghoo1, d1ghoo2, d1ghoo3, d1ghoo5 |
View in 3DDomains from other chains: (mouse over for more information) d1ghoi1, d1ghoi2, d1ghoi3, d1ghoi4, d1ghoi5, d1ghoj1, d1ghoj2, d1ghoj3, d1ghoj4, d1ghoj5, d1ghok1, d1ghok2, d1ghok3, d1ghok4, d1ghok5, d1ghol1, d1ghol2, d1ghol3, d1ghol4, d1ghol5, d1ghom1, d1ghom2, d1ghom3, d1ghom4, d1ghom5, d1ghon1, d1ghon2, d1ghon3, d1ghon4, d1ghon5, d1ghop1, d1ghop2, d1ghop3, d1ghop4, d1ghop5 |