Lineage for d1ghom3 (1gho M:3-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774233Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2774234Protein beta-Galactosidase [49804] (3 species)
  7. 2774242Species Escherichia coli [TaxId:562] [49805] (46 PDB entries)
    Uniprot P00722
  8. 2774375Domain d1ghom3: 1gho M:3-219 [23754]
    Other proteins in same PDB: d1ghoi1, d1ghoi2, d1ghoi4, d1ghoi5, d1ghoj1, d1ghoj2, d1ghoj4, d1ghoj5, d1ghok1, d1ghok2, d1ghok4, d1ghok5, d1ghol1, d1ghol2, d1ghol4, d1ghol5, d1ghom1, d1ghom2, d1ghom4, d1ghom5, d1ghon1, d1ghon2, d1ghon4, d1ghon5, d1ghoo1, d1ghoo2, d1ghoo4, d1ghoo5, d1ghop1, d1ghop2, d1ghop4, d1ghop5
    complexed with mg
    complexed with mg

Details for d1ghom3

PDB Entry: 1gho (more details), 2.5 Å

PDB Description: e. coli (lac z) beta-galactosidase (ncs constrained monomer-monoclinic)
PDB Compounds: (M:) beta-galactosidase

SCOPe Domain Sequences for d1ghom3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghom3 b.18.1.5 (M:3-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
itdslavvlqrrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfaw
fpapeavpeswlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgc
ysltfnvdeswlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragen
rlavmvlrwsdgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d1ghom3:

Click to download the PDB-style file with coordinates for d1ghom3.
(The format of our PDB-style files is described here.)

Timeline for d1ghom3: