| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
| Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
| Protein beta-Galactosidase, domain 3 [51510] (3 species) |
| Species Escherichia coli [TaxId:562] [51511] (46 PDB entries) Uniprot P00722 |
| Domain d1ghoj5: 1gho J:334-625 [28874] Other proteins in same PDB: d1ghoi1, d1ghoi2, d1ghoi3, d1ghoi4, d1ghoj1, d1ghoj2, d1ghoj3, d1ghoj4, d1ghok1, d1ghok2, d1ghok3, d1ghok4, d1ghol1, d1ghol2, d1ghol3, d1ghol4, d1ghom1, d1ghom2, d1ghom3, d1ghom4, d1ghon1, d1ghon2, d1ghon3, d1ghon4, d1ghoo1, d1ghoo2, d1ghoo3, d1ghoo4, d1ghop1, d1ghop2, d1ghop3, d1ghop4 complexed with mg complexed with mg |
PDB Entry: 1gho (more details), 2.5 Å
SCOPe Domain Sequences for d1ghoj5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ghoj5 c.1.8.3 (J:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d1ghoj5:
View in 3DDomains from same chain: (mouse over for more information) d1ghoj1, d1ghoj2, d1ghoj3, d1ghoj4 |
View in 3DDomains from other chains: (mouse over for more information) d1ghoi1, d1ghoi2, d1ghoi3, d1ghoi4, d1ghoi5, d1ghok1, d1ghok2, d1ghok3, d1ghok4, d1ghok5, d1ghol1, d1ghol2, d1ghol3, d1ghol4, d1ghol5, d1ghom1, d1ghom2, d1ghom3, d1ghom4, d1ghom5, d1ghon1, d1ghon2, d1ghon3, d1ghon4, d1ghon5, d1ghoo1, d1ghoo2, d1ghoo3, d1ghoo4, d1ghoo5, d1ghop1, d1ghop2, d1ghop3, d1ghop4, d1ghop5 |