SCOPe 2.07: Domain d2ntfl2: 2ntf L:109-211

Lineage for d2ntfl2 (2ntf L:109-211)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d2ntfl2: 2ntf L:109-211 [243236]
   Other proteins in same PDB: d2ntfa1, d2ntfl1
   automated match to d2op4l2
   complexed with ohm

Details for d2ntfl2

PDB Entry: 2ntf, 3.18 Å

PDB Description: Crystal Structure of a Quorum-Quenching Antibody in Complex with an N-Acyl-L-Homoserine Lactone Analog

PDB Compounds: (L:) Murine Antibody Fab RS2-1G9 Lambda Light Chain

SCOPe Domain Sequences for d2ntfl2:

Sequence; same for both SEQRES and ATOM records:

>d2ntfl2 b.1.1.2 (L:109-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqs
nnkymassyltltagawerhssyscqvtheghtvekslsr

Timeline for d2ntfl2:

• d2ntfl2 first appeared in SCOPe 2.04
  
• d2ntfl2 appears in SCOPe 2.06
  
• d2ntfl2 appears in the current release, SCOPe 2.08