Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries) |
Domain d2ntfa1: 2ntf A:1-108 [243233] Other proteins in same PDB: d2ntfa2, d2ntfl2 automated match to d2op4l1 complexed with ohm |
PDB Entry: 2ntf (more details), 3.18 Å
SCOPe Domain Sequences for d2ntfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ntfa1 b.1.1.1 (A:1-108) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qavvtqesalttspgetvtltcrsstgavttrnyanwvqekpdhfftgligdtnnrapgv parfsgslighkaaltitgaqtedesvyfcalwysnhwvfgggtkltvlgq
Timeline for d2ntfa1: