![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (16 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries) |
![]() | Domain d2ntfl2: 2ntf L:109-211 [243236] Other proteins in same PDB: d2ntfa1, d2ntfl1 automated match to d2op4l2 complexed with ohm |
PDB Entry: 2ntf (more details), 3.18 Å
SCOPe Domain Sequences for d2ntfl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ntfl2 b.1.1.2 (L:109-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]} pksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqs nnkymassyltltagawerhssyscqvtheghtvekslsr
Timeline for d2ntfl2: