Lineage for d2ntfl2 (2ntf L:109-211)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (649 PDB entries)
  8. 2753022Domain d2ntfl2: 2ntf L:109-211 [243236]
    Other proteins in same PDB: d2ntfa1, d2ntfb_, d2ntfh_, d2ntfl1
    automated match to d2op4l2
    complexed with ohm

Details for d2ntfl2

PDB Entry: 2ntf (more details), 3.18 Å

PDB Description: Crystal Structure of a Quorum-Quenching Antibody in Complex with an N-Acyl-L-Homoserine Lactone Analog
PDB Compounds: (L:) Murine Antibody Fab RS2-1G9 Lambda Light Chain

SCOPe Domain Sequences for d2ntfl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ntfl2 b.1.1.2 (L:109-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqs
nnkymassyltltagawerhssyscqvtheghtvekslsr

SCOPe Domain Coordinates for d2ntfl2:

Click to download the PDB-style file with coordinates for d2ntfl2.
(The format of our PDB-style files is described here.)

Timeline for d2ntfl2: