SCOPe 2.08: Domain d2hr7a2: 2hr7 A:157-311

Lineage for d2hr7a2 (2hr7 A:157-311)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.9: Growth factor receptor domain [57184] (2 families)

5. Family g.3.9.0: automated matches [232406] (1 protein)
   not a true family

6. Protein automated matches [232407] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [232408] (18 PDB entries)

8. Domain d2hr7a2: 2hr7 A:157-311 [242061]
   Other proteins in same PDB: d2hr7a1, d2hr7a3, d2hr7b1, d2hr7b3
   automated match to d2dtge6
   complexed with gol, nag, p33, so4

Details for d2hr7a2

PDB Entry: 2hr7, 2.32 Å

PDB Description: insulin receptor (domains 1-3)

PDB Compounds: (A:) Insulin receptor

SCOPe Domain Sequences for d2hr7a2:

Sequence; same for both SEQRES and ATOM records:

>d2hr7a2 g.3.9.0 (A:157-311) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dicpgtakgktncpatvingqfvercwthshcqkvcptickshgctaeglcchseclgnc
sqpddptkcvacrnfyldgrcvetcpppyyhfqdwrcvnfsfcqdlhhkcknsrrqgchq
yvihnnkcipecpsgytmnssnllctpclgpcpkv

Timeline for d2hr7a2:

• d2hr7a2 first appeared in SCOPe 2.04
  
• d2hr7a2 appears in SCOPe 2.07