PDB entry 2hr7

View 2hr7 on RCSB PDB site
Description: Insulin receptor (domains 1-3)
Class: transferase
Keywords: hormone receptor, leucine rich repeat, transferase
Deposited on 2006-07-19, released 2006-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: 0.197
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Insulin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: INSR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06213
      • variant (143)
      • variant (420)
    Domains in SCOPe 2.07: d2hr7a1, d2hr7a2, d2hr7a3
  • Chain 'B':
    Compound: Insulin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: INSR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06213
      • variant (143)
      • variant (420)
    Domains in SCOPe 2.07: d2hr7b1, d2hr7b2, d2hr7b3
  • Heterogens: NAG, SO4, P33, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hr7A (A:)
    hlypgevcpgmdirnnltrlhelencsvieghlqillmfktrpedfrdlsfpklimitdy
    lllfrvygleslkdlfpnltvirgsrlffnyalvifemvhlkelglynlmnitrgsvrie
    knnelcylatidwsrildsvednhivlnkddneecgdicpgtakgktncpatvingqfve
    rcwthshcqkvcptickshgctaeglcchseclgncsqpddptkcvacrnfyldgrcvet
    cpppyyhfqdwrcvnfsfcqdlhhkcknsrrqgchqyvihnnkcipecpsgytmnssnll
    ctpclgpcpkvchllegektidsvtsaqelrgctvingsliinirggnnlaaeleanlgl
    ieeisgylkirrsyalvslsffrklrlirgetleignysfyaldnqnlrqlwdwskhnlt
    itqgklffhynpklclseihkmeevsgtkgrqerndialktngdkascenellkfsyirt
    sfdkis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hr7A (A:)
    pgevcpgmdirnnltrlhelencsvieghlqillmfktrpedfrdlsfpklimitdylll
    frvygleslkdlfpnltvirgsrlffnyalvifemvhlkelglynlmnitrgsvrieknn
    elcylatidwsrildsvednhivlnkddneecgdicpgtakgktncpatvingqfvercw
    thshcqkvcptickshgctaeglcchseclgncsqpddptkcvacrnfyldgrcvetcpp
    pyyhfqdwrcvnfsfcqdlhhkcknsrrqgchqyvihnnkcipecpsgytmnssnllctp
    clgpcpkvchllegektidsvtsaqelrgctvingsliinirggnnlaaeleanlgliee
    isgylkirrsyalvslsffrklrlirgetleignysfyaldnqnlrqlwdwskhnltitq
    gklffhynpklclseihkmeevsgtkgrqerndialktngdkasce
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hr7B (B:)
    hlypgevcpgmdirnnltrlhelencsvieghlqillmfktrpedfrdlsfpklimitdy
    lllfrvygleslkdlfpnltvirgsrlffnyalvifemvhlkelglynlmnitrgsvrie
    knnelcylatidwsrildsvednhivlnkddneecgdicpgtakgktncpatvingqfve
    rcwthshcqkvcptickshgctaeglcchseclgncsqpddptkcvacrnfyldgrcvet
    cpppyyhfqdwrcvnfsfcqdlhhkcknsrrqgchqyvihnnkcipecpsgytmnssnll
    ctpclgpcpkvchllegektidsvtsaqelrgctvingsliinirggnnlaaeleanlgl
    ieeisgylkirrsyalvslsffrklrlirgetleignysfyaldnqnlrqlwdwskhnlt
    itqgklffhynpklclseihkmeevsgtkgrqerndialktngdkascenellkfsyirt
    sfdkis
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hr7B (B:)
    pgevcpgmdirnnltrlhelencsvieghlqillmfktrpedfrdlsfpklimitdylll
    frvygleslkdlfpnltvirgsrlffnyalvifemvhlkelglynlmnitrgsvrieknn
    elcylatidwsrildsvednhivlnkddneecgdicpgtakgtncpatvingqfvercwt
    hshcqkvcptickshgctaeglcchseclgncsqpddptkcvacrnfyldgrcvetcppp
    yyhfqdwrcvnfsfcqdlhhkcknsrrgchqyvihnnkcipecpsgytmnssnllctpcl
    gpcpkvchllegektidsvtsaqelrgctvingsliinirggnnlaaeleanlglieeis
    gylkirrsyalvslsffrklrlirgetleignysfyaldnqnlrqlwdwskhnltitqgk
    lffhynpklclseihkmeevsgtkgrqerndialktngdkascen