| Class g: Small proteins [56992] (98 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) ![]() |
| Family g.3.9.0: automated matches [232406] (1 protein) not a true family |
| Protein automated matches [232407] (3 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [232408] (18 PDB entries) |
| Domain d2hr7a2: 2hr7 A:157-311 [242061] Other proteins in same PDB: d2hr7a1, d2hr7a3, d2hr7b1, d2hr7b3 automated match to d2dtge6 complexed with gol, nag, p33, so4 |
PDB Entry: 2hr7 (more details), 2.32 Å
SCOPe Domain Sequences for d2hr7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hr7a2 g.3.9.0 (A:157-311) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dicpgtakgktncpatvingqfvercwthshcqkvcptickshgctaeglcchseclgnc
sqpddptkcvacrnfyldgrcvetcpppyyhfqdwrcvnfsfcqdlhhkcknsrrqgchq
yvihnnkcipecpsgytmnssnllctpclgpcpkv
Timeline for d2hr7a2: