Lineage for d2hr7b2 (2hr7 B:157-311)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635726Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 2635797Family g.3.9.0: automated matches [232406] (1 protein)
    not a true family
  6. 2635798Protein automated matches [232407] (3 species)
    not a true protein
  7. 2635799Species Human (Homo sapiens) [TaxId:9606] [232408] (18 PDB entries)
  8. 2635801Domain d2hr7b2: 2hr7 B:157-311 [242064]
    Other proteins in same PDB: d2hr7a1, d2hr7a3, d2hr7b1, d2hr7b3
    automated match to d2dtge6
    complexed with gol, nag, p33, so4

Details for d2hr7b2

PDB Entry: 2hr7 (more details), 2.32 Å

PDB Description: insulin receptor (domains 1-3)
PDB Compounds: (B:) Insulin receptor

SCOPe Domain Sequences for d2hr7b2:

Sequence, based on SEQRES records: (download)

>d2hr7b2 g.3.9.0 (B:157-311) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dicpgtakgktncpatvingqfvercwthshcqkvcptickshgctaeglcchseclgnc
sqpddptkcvacrnfyldgrcvetcpppyyhfqdwrcvnfsfcqdlhhkcknsrrqgchq
yvihnnkcipecpsgytmnssnllctpclgpcpkv

Sequence, based on observed residues (ATOM records): (download)

>d2hr7b2 g.3.9.0 (B:157-311) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dicpgtakgtncpatvingqfvercwthshcqkvcptickshgctaeglcchseclgncs
qpddptkcvacrnfyldgrcvetcpppyyhfqdwrcvnfsfcqdlhhkcknsrrgchqyv
ihnnkcipecpsgytmnssnllctpclgpcpkv

SCOPe Domain Coordinates for d2hr7b2:

Click to download the PDB-style file with coordinates for d2hr7b2.
(The format of our PDB-style files is described here.)

Timeline for d2hr7b2: