SCOPe 2.04: Domain d2a73b6: 2a73 B:912-962,B:1269-1330

Lineage for d2a73b6 (2a73 B:912-962,B:1269-1330)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.23: CUB-like [49853] (4 superfamilies)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.23.4: Complement system CUB domain [254131] (1 family)

5. Family b.23.4.1: Complement system CUB domain [254165] (2 proteins)

6. Protein Complement C3 CUB domain [254371] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [254804] (1 PDB entry)

8. Domain d2a73b6: 2a73 B:912-962,B:1269-1330 [241227]
   Other proteins in same PDB: d2a73.1, d2a73a1, d2a73a2, d2a73a3, d2a73a4, d2a73a5, d2a73a6, d2a73b1, d2a73b2, d2a73b3, d2a73b4, d2a73b5, d2a73b7, d2a73b8

Details for d2a73b6

PDB Entry: 2a73, 3.3 Å

PDB Description: human complement component c3

PDB Compounds: (B:) Complement C3

SCOPe Domain Sequences for d2a73b6:

Sequence; same for both SEQRES and ATOM records:

>d2a73b6 b.23.4.1 (B:912-962,B:1269-1330) Complement C3 CUB domain {Human (Homo sapiens) [TaxId: 9606]}
egirmnktvavrtldperlgregvqkedippadlsdqvpdtesetrillqgXelnldvsl
qlpsrsskithrihwesasllrseetkenegftvtaegkgqgtlsvvtmyhaka

Timeline for d2a73b6:

• d2a73b6 is new in SCOPe 2.04-stable
  
• d2a73b6 appears in SCOPe 2.05
  
• d2a73b6 appears in the current release, SCOPe 2.08