Lineage for d2a73b2 (2a73 B:1331-1474)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1525092Superfamily b.1.29: Macroglobulin [254121] (8 families) (S)
    C3 MG domains possibly arose by gene duplication according to PubMed 16177781; PubMed 17608619; possibly related to immunoglobulins according to Pfam clan annotations
  5. 1525093Family b.1.29.1: Alpha-macroglobulin receptor domain [254148] (4 proteins)
    Pfam PF07677
  6. 1525104Protein Complement C3 MG8 [254362] (1 species)
  7. 1525105Species Human (Homo sapiens) [TaxId:9606] [254795] (1 PDB entry)
  8. 1525106Domain d2a73b2: 2a73 B:1331-1474 [241223]
    Other proteins in same PDB: d2a73.1, d2a73a1, d2a73a2, d2a73a3, d2a73a4, d2a73a5, d2a73a6, d2a73b1, d2a73b3, d2a73b4, d2a73b5, d2a73b6, d2a73b7, d2a73b8

Details for d2a73b2

PDB Entry: 2a73 (more details), 3.3 Å

PDB Description: human complement component c3
PDB Compounds: (B:) Complement C3

SCOPe Domain Sequences for d2a73b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a73b2 b.1.29.1 (B:1331-1474) Complement C3 MG8 {Human (Homo sapiens) [TaxId: 9606]}
kdqltcnkfdlkvtikpapetekrpqdakntmileictryrgdqdatmsildismmtgfa
pdtddlkqlangvdryiskyeldkafsdrntliiyldkvshseddclafkvhqyfnveli
qpgavkvyayynleesctrfyhpe

SCOPe Domain Coordinates for d2a73b2:

Click to download the PDB-style file with coordinates for d2a73b2.
(The format of our PDB-style files is described here.)

Timeline for d2a73b2: