Lineage for d2a73b1 (2a73 B:807-911)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1525092Superfamily b.1.29: Macroglobulin [254121] (8 families) (S)
    C3 MG domains possibly arose by gene duplication according to PubMed 16177781; PubMed 17608619; possibly related to immunoglobulins according to Pfam clan annotations
  5. 1525163Family b.1.29.8: Complement C3 MG7-like [254161] (2 proteins)
  6. 1525164Protein Complement C3 MG7 [254360] (1 species)
  7. 1525165Species Human (Homo sapiens) [TaxId:9606] [254793] (1 PDB entry)
  8. 1525166Domain d2a73b1: 2a73 B:807-911 [241222]
    Other proteins in same PDB: d2a73.1, d2a73a1, d2a73a2, d2a73a3, d2a73a4, d2a73a5, d2a73a6, d2a73b2, d2a73b3, d2a73b4, d2a73b5, d2a73b6, d2a73b7, d2a73b8

Details for d2a73b1

PDB Entry: 2a73 (more details), 3.3 Å

PDB Description: human complement component c3
PDB Compounds: (B:) Complement C3

SCOPe Domain Sequences for d2a73b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a73b1 b.1.29.8 (B:807-911) Complement C3 MG7 {Human (Homo sapiens) [TaxId: 9606]}
ffidlrlpysvvrneqveiravlynyrqnqelkvrvellhnpafcslattkrrhqqtvti
ppksslsvpyvivplktglqevevkaavyhhfisdgvrkslkvvp

SCOPe Domain Coordinates for d2a73b1:

Click to download the PDB-style file with coordinates for d2a73b1.
(The format of our PDB-style files is described here.)

Timeline for d2a73b1: