| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.29: Macroglobulin [254121] (8 families) ![]() C3 MG domains possibly arose by gene duplication according to PubMed 16177781; PubMed 17608619; possibly related to immunoglobulins according to Pfam clan annotations |
| Family b.1.29.8: Complement C3 MG7-like [254161] (2 proteins) |
| Protein Complement C3 MG7 [254360] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [254793] (1 PDB entry) |
| Domain d2a73b1: 2a73 B:807-911 [241222] Other proteins in same PDB: d2a73.1, d2a73a1, d2a73a2, d2a73a3, d2a73a4, d2a73a5, d2a73a6, d2a73b2, d2a73b3, d2a73b4, d2a73b5, d2a73b6, d2a73b7, d2a73b8 |
PDB Entry: 2a73 (more details), 3.3 Å
SCOPe Domain Sequences for d2a73b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a73b1 b.1.29.8 (B:807-911) Complement C3 MG7 {Human (Homo sapiens) [TaxId: 9606]}
ffidlrlpysvvrneqveiravlynyrqnqelkvrvellhnpafcslattkrrhqqtvti
ppksslsvpyvivplktglqevevkaavyhhfisdgvrkslkvvp
Timeline for d2a73b1: