SCOPe 2.04: Domain d2a73b3: 2a73 B:651-719

Lineage for d2a73b3 (2a73 B:651-719)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily)
   4 helices; irregular array, disulfide-linked

4. Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family)

5. Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins)
   can be classified as disulfide-rich
   Pfam PF01821

6. Protein C3 ANA (anaphylatoxin) domain [254366] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [254799] (1 PDB entry)

8. Domain d2a73b3: 2a73 B:651-719 [241224]
   Other proteins in same PDB: d2a73.1, d2a73a1, d2a73a2, d2a73a3, d2a73a4, d2a73a5, d2a73a6, d2a73b1, d2a73b2, d2a73b4, d2a73b5, d2a73b6, d2a73b7, d2a73b8

Details for d2a73b3

PDB Entry: 2a73, 3.3 Å

PDB Description: human complement component c3

PDB Compounds: (B:) Complement C3

SCOPe Domain Sequences for d2a73b3:

Sequence; same for both SEQRES and ATOM records:

>d2a73b3 a.50.1.1 (B:651-719) C3 ANA (anaphylatoxin) domain {Human (Homo sapiens) [TaxId: 9606]}
vqltekrmdkvgkypkelrkccedgmrenpmrfscqrrtrfislgeackkvfldccnyit
elrrqhara

Timeline for d2a73b3:

• d2a73b3 is new in SCOPe 2.04-stable
  
• d2a73b3 appears in SCOPe 2.05
  
• d2a73b3 appears in the current release, SCOPe 2.08