Lineage for d2a73b6 (2a73 B:912-962,B:1269-1330)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777703Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777785Superfamily b.23.4: Complement system CUB domain [254131] (1 family) (S)
  5. 2777786Family b.23.4.1: Complement system CUB domain [254165] (2 proteins)
  6. 2777787Protein Complement C3 CUB domain [254371] (1 species)
  7. 2777788Species Human (Homo sapiens) [TaxId:9606] [254804] (1 PDB entry)
  8. 2777789Domain d2a73b6: 2a73 B:912-962,B:1269-1330 [241227]
    Other proteins in same PDB: d2a73.1, d2a73a1, d2a73a2, d2a73a3, d2a73a4, d2a73a5, d2a73a6, d2a73b1, d2a73b2, d2a73b3, d2a73b4, d2a73b5, d2a73b7, d2a73b8

Details for d2a73b6

PDB Entry: 2a73 (more details), 3.3 Å

PDB Description: human complement component c3
PDB Compounds: (B:) Complement C3

SCOPe Domain Sequences for d2a73b6:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a73b6 b.23.4.1 (B:912-962,B:1269-1330) Complement C3 CUB domain {Human (Homo sapiens) [TaxId: 9606]}
egirmnktvavrtldperlgregvqkedippadlsdqvpdtesetrillqgXelnldvsl
qlpsrsskithrihwesasllrseetkenegftvtaegkgqgtlsvvtmyhaka

SCOPe Domain Coordinates for d2a73b6:

Click to download the PDB-style file with coordinates for d2a73b6.
(The format of our PDB-style files is described here.)

Timeline for d2a73b6: