Lineage for d3cika1 (3cik A:29-185)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719790Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2719791Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2719852Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 2719853Protein automated matches [190464] (3 species)
    not a true protein
  7. 2719862Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries)
  8. 2719883Domain d3cika1: 3cik A:29-185 [239181]
    Other proteins in same PDB: d3cika2, d3cika3, d3cikb_, d3cikg_
    automated match to d1omwa1
    complexed with mg

Details for d3cika1

PDB Entry: 3cik (more details), 2.75 Å

PDB Description: Human GRK2 in Complex with Gbetagamma subunits
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d3cika1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cika1 a.91.1.0 (A:29-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclnhleearplvefyee
ikkyekleteeervarsreifdsyimkellacshpfsksatehvqghlgkkqvppdlfqp
yieeicqnlrgdvfqkfiesdkftrfcqwknvelnih

SCOPe Domain Coordinates for d3cika1:

Click to download the PDB-style file with coordinates for d3cika1.
(The format of our PDB-style files is described here.)

Timeline for d3cika1: