SCOPe 2.08: Domain d3cika3: 3cik A:550-669

Lineage for d3cika3 (3cik A:550-669)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)

8. Domain d3cika3: 3cik A:550-669 [239183]
   Other proteins in same PDB: d3cika1, d3cika2, d3cikb_, d3cikg_
   automated match to d1omwa2
   complexed with mg

Details for d3cika3

PDB Entry: 3cik, 2.75 Å

PDB Description: Human GRK2 in Complex with Gbetagamma subunits

PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d3cika3:

Sequence, based on SEQRES records:

>d3cika3 b.55.1.0 (A:550-669) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv
eetqikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkpr

Sequence, based on observed residues (ATOM records):

>d3cika3 b.55.1.0 (A:550-669) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eedyalgkdcimhgymskmtqwqrryfylfpnrlewrgegeapqslltmeeiqsveetqi
kerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkpr

Timeline for d3cika3:

• d3cika3 first appeared in SCOPe 2.04
  
• d3cika3 appears in SCOPe 2.07