Lineage for d3cika3 (3cik A:550-669)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803713Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2803714Protein automated matches [190052] (8 species)
    not a true protein
  7. 2803789Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)
  8. 2803885Domain d3cika3: 3cik A:550-669 [239183]
    Other proteins in same PDB: d3cika1, d3cika2, d3cikb_, d3cikg_
    automated match to d1omwa2
    complexed with mg

Details for d3cika3

PDB Entry: 3cik (more details), 2.75 Å

PDB Description: Human GRK2 in Complex with Gbetagamma subunits
PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d3cika3:

Sequence, based on SEQRES records: (download)

>d3cika3 b.55.1.0 (A:550-669) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv
eetqikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkpr

Sequence, based on observed residues (ATOM records): (download)

>d3cika3 b.55.1.0 (A:550-669) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eedyalgkdcimhgymskmtqwqrryfylfpnrlewrgegeapqslltmeeiqsveetqi
kerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkpr

SCOPe Domain Coordinates for d3cika3:

Click to download the PDB-style file with coordinates for d3cika3.
(The format of our PDB-style files is described here.)

Timeline for d3cika3: