![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) ![]() long alpha-helix interrupted in the middle automatically mapped to Pfam PF00631 |
![]() | Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (2 proteins) |
![]() | Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [48673] (72 PDB entries) |
![]() | Domain d3cikg_: 3cik G: [173249] Other proteins in same PDB: d3cika1, d3cika2, d3cika3, d3cikb_ automated match to d1omwg_ complexed with mg |
PDB Entry: 3cik (more details), 2.75 Å
SCOPe Domain Sequences for d3cikg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cikg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]} siaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfrekkff c
Timeline for d3cikg_:
![]() Domains from other chains: (mouse over for more information) d3cika1, d3cika2, d3cika3, d3cikb_ |