Class a: All alpha proteins [46456] (285 folds) |
Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) |
Family a.91.1.0: automated matches [191379] (1 protein) not a true family |
Protein automated matches [190464] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187381] (25 PDB entries) |
Domain d3cika1: 3cik A:29-185 [239181] Other proteins in same PDB: d3cika2, d3cika3, d3cikb_, d3cikg_ automated match to d1omwa1 complexed with mg |
PDB Entry: 3cik (more details), 2.75 Å
SCOPe Domain Sequences for d3cika1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cika1 a.91.1.0 (A:29-185) automated matches {Human (Homo sapiens) [TaxId: 9606]} skkillpepsirsvmqkyledrgevtfekifsqklgyllfrdfclnhleearplvefyee ikkyekleteeervarsreifdsyimkellacshpfsksatehvqghlgkkqvppdlfqp yieeicqnlrgdvfqkfiesdkftrfcqwknvelnih
Timeline for d3cika1: