Lineage for d2w3rg3 (2w3r G:179-345)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2987459Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2987460Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2987703Family d.145.1.0: automated matches [191624] (1 protein)
    not a true family
  6. 2987704Protein automated matches [191143] (13 species)
    not a true protein
  7. 2987745Species Rhodobacter capsulatus [TaxId:1061] [255637] (2 PDB entries)
  8. 2987753Domain d2w3rg3: 2w3r G:179-345 [238910]
    Other proteins in same PDB: d2w3ra1, d2w3ra2, d2w3ra4, d2w3rb1, d2w3rb2, d2w3rc1, d2w3rc2, d2w3rc4, d2w3rd1, d2w3rd2, d2w3re1, d2w3re2, d2w3re4, d2w3rf1, d2w3rf2, d2w3rg1, d2w3rg2, d2w3rg4, d2w3rh1, d2w3rh2
    automated match to d1jroa4
    complexed with ca, fad, fes, hpa, mom, mte

Details for d2w3rg3

PDB Entry: 2w3r (more details), 2.9 Å

PDB Description: crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with hypoxanthine
PDB Compounds: (G:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d2w3rg3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w3rg3 d.145.1.0 (G:179-345) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
paflpetsdaladwylahpeatliaggtdvslwvtkalrdlpevaflshckdlaqiretp
dgygigagvtiaalrafaegphpalagllrrfaseqvrqvatiggniangspigdgppal
iamgasltlrrgqerrrmpledffleyrkqdrrpgefvesvtlpksa

SCOPe Domain Coordinates for d2w3rg3:

Click to download the PDB-style file with coordinates for d2w3rg3.
(The format of our PDB-style files is described here.)

Timeline for d2w3rg3: