Lineage for d2w3ra4 (2w3r A:346-462)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962835Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2962998Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 2963058Family d.87.2.0: automated matches [232089] (1 protein)
    not a true family
  6. 2963059Protein automated matches [232090] (5 species)
    not a true protein
  7. 2963091Species Rhodobacter capsulatus [TaxId:1061] [255638] (2 PDB entries)
  8. 2963096Domain d2w3ra4: 2w3r A:346-462 [238899]
    Other proteins in same PDB: d2w3ra1, d2w3ra2, d2w3ra3, d2w3rb1, d2w3rb2, d2w3rc1, d2w3rc2, d2w3rc3, d2w3rd1, d2w3rd2, d2w3re1, d2w3re2, d2w3re3, d2w3rf1, d2w3rf2, d2w3rg1, d2w3rg2, d2w3rg3, d2w3rh1, d2w3rh2
    automated match to d1jroa3
    complexed with ca, fad, fes, hpa, mom, mte

Details for d2w3ra4

PDB Entry: 2w3r (more details), 2.9 Å

PDB Description: crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with hypoxanthine
PDB Compounds: (A:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d2w3ra4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w3ra4 d.87.2.0 (A:346-462) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
pglrcyklskrfdqdisavcgclnltlkgskietariafggmagvpkraaafeaaligqd
fredtiaaalpllaqdftplsdmrasaayrmnaaqamalryvrelsgeavavlevmp

SCOPe Domain Coordinates for d2w3ra4:

Click to download the PDB-style file with coordinates for d2w3ra4.
(The format of our PDB-style files is described here.)

Timeline for d2w3ra4: