Lineage for d2w3re2 (2w3r E:85-166)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715250Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2715251Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2715358Family a.56.1.0: automated matches [227241] (1 protein)
    not a true family
  6. 2715359Protein automated matches [227007] (6 species)
    not a true protein
  7. 2715370Species Rhodobacter capsulatus [TaxId:1061] [255636] (2 PDB entries)
  8. 2715377Domain d2w3re2: 2w3r E:85-166 [238905]
    Other proteins in same PDB: d2w3ra1, d2w3ra3, d2w3ra4, d2w3rb1, d2w3rb2, d2w3rc1, d2w3rc3, d2w3rc4, d2w3rd1, d2w3rd2, d2w3re1, d2w3re3, d2w3re4, d2w3rf1, d2w3rf2, d2w3rg1, d2w3rg3, d2w3rg4, d2w3rh1, d2w3rh2
    automated match to d1jroa1
    complexed with ca, fad, fes, hpa, mom, mte

Details for d2w3re2

PDB Entry: 2w3r (more details), 2.9 Å

PDB Description: crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with hypoxanthine
PDB Compounds: (E:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d2w3re2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w3re2 a.56.1.0 (E:85-166) automated matches {Rhodobacter capsulatus [TaxId: 1061]}
dgrlhpvqqamidhhgsqcgfctpgfivsmaaahdrdrkdyddllagnlcrctgyapilr
aaeaaageppadwlqadaaftl

SCOPe Domain Coordinates for d2w3re2:

Click to download the PDB-style file with coordinates for d2w3re2.
(The format of our PDB-style files is described here.)

Timeline for d2w3re2: