Lineage for d2w3rf1 (2w3r F:2-123)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2944851Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 2944852Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 2944896Protein Xanthine dehydrogenase chain B, N-terminal domain [69691] (1 species)
  7. 2944897Species Rhodobacter capsulatus [TaxId:1061] [69692] (4 PDB entries)
  8. 2944908Domain d2w3rf1: 2w3r F:2-123 [206591]
    Other proteins in same PDB: d2w3ra1, d2w3ra2, d2w3ra3, d2w3ra4, d2w3rb2, d2w3rc1, d2w3rc2, d2w3rc3, d2w3rc4, d2w3rd2, d2w3re1, d2w3re2, d2w3re3, d2w3re4, d2w3rf2, d2w3rg1, d2w3rg2, d2w3rg3, d2w3rg4, d2w3rh2
    automated match to d1jrob1
    complexed with ca, fad, fes, hpa, mom, mte

Details for d2w3rf1

PDB Entry: 2w3r (more details), 2.9 Å

PDB Description: crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with hypoxanthine
PDB Compounds: (F:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d2w3rf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w3rf1 d.41.1.1 (F:2-123) Xanthine dehydrogenase chain B, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]}
svgkplphdsarahvtgqarylddlpcpantlhlafglsteasaaitgldlepvrespgv
iavftaadlphdndaspapspepvlatgevhfvgqpiflvaatshraariaarkaritya
pr

SCOPe Domain Coordinates for d2w3rf1:

Click to download the PDB-style file with coordinates for d2w3rf1.
(The format of our PDB-style files is described here.)

Timeline for d2w3rf1: