Lineage for d2w3rd2 (2w3r D:124-777)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2540508Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 2540509Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (2 families) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
    automatically mapped to Pfam PF02738
  5. 2540510Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 protein domains)
  6. 2540554Protein Xanthine dehydrogenase chain B, C-terminal domain [69813] (1 species)
  7. 2540555Species Rhodobacter capsulatus [TaxId:1061] [69814] (4 PDB entries)
  8. 2540565Domain d2w3rd2: 2w3r D:124-777 [206590]
    Other proteins in same PDB: d2w3ra1, d2w3ra2, d2w3ra3, d2w3ra4, d2w3rb1, d2w3rc1, d2w3rc2, d2w3rc3, d2w3rc4, d2w3rd1, d2w3re1, d2w3re2, d2w3re3, d2w3re4, d2w3rf1, d2w3rg1, d2w3rg2, d2w3rg3, d2w3rg4, d2w3rh1
    automated match to d1jrob2
    complexed with ca, fad, fes, hpa, mom, mte

Details for d2w3rd2

PDB Entry: 2w3r (more details), 2.9 Å

PDB Description: crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with hypoxanthine
PDB Compounds: (D:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d2w3rd2:

Sequence, based on SEQRES records: (download)

>d2w3rd2 d.133.1.1 (D:124-777) Xanthine dehydrogenase chain B, C-terminal domain {Rhodobacter capsulatus [TaxId: 1061]}
pailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqaala
lpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlaiaca
vaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgwsadl
slpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehlarg
mgrdpaelralnfydppergglsappsppepiatkktqtthygqevadcvlgelvtrlqk
sanfttrraeiaawnstnrtlargialspvkfgisftlthlnqagalvqiytdgsvalnh
ggtemgqglhakmvqvaaavlgidpvqvritatdtskvpntsataassgadmngmavkda
cetlrgrlagfvaaregcaardvifdagqvqasgkswrfaeivaaaymarislsatgfya
tpklswdrlrgqgrpflyfaygaaitevvidrltgenrilrtdilhdagaslnpaldigq
iegayvqgagwltteelvwdhcgrlmthapstykipafsdrprifnvalwdqpnreetif
rskavgeppfllgisaflalhdacaacgphwpdlqapatpeavlaavrraegra

Sequence, based on observed residues (ATOM records): (download)

>d2w3rd2 d.133.1.1 (D:124-777) Xanthine dehydrogenase chain B, C-terminal domain {Rhodobacter capsulatus [TaxId: 1061]}
pailtldqalaadsrfeggpviwargdvetalagaahlaegcfeiggqehfylegqaala
lpaeggvvihcssqhpseiqhkvahalglafhdvrvemrrmgggfggkesqgnhlaiaca
vaaratgrpckmrydrdddmvitgkrhdfriryrigadasgkllgadfvhlarcgwsadl
slpvcdramlhadgsyfvpalrieshrlrtntqsntafrgfggpqgalgmeraiehlarg
mgrdpaelralnfydppekktqtthygqevadcvlgelvtrlqksanfttrraeiaawns
tnrtlargialspvkfgisftlthlnqagalvqiytdgsvalnhggtemgqglhakmvqv
aaavlgidpvqvritatdtskvpntsataassgadmngmavkdacetlrgrlagfvaare
gcaardvifdagqvqasgkswrfaeivaaaymarislsatgfyatpklswdrlrgqgrpf
lyfaygaaitevvidrltgenrilrtdilhdagaslnpaldigqiegayvqgagwlttee
lvwdhcgrlmthapstykipafsdrprifnvalwdqpnreetifrskavgeppfllgisa
flalhdacaacgphwpdlqapatpeavlaavrraegra

SCOPe Domain Coordinates for d2w3rd2:

Click to download the PDB-style file with coordinates for d2w3rd2.
(The format of our PDB-style files is described here.)

Timeline for d2w3rd2: